Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAN Peptide - middle region

GAN Peptide - middle region

Product Specifications

Product Name Alternative

FLJ38059, GAN1, KLHL16

UniProt

Q9H2C0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GAN Rabbit Polyclonal Antibody (orb326258) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071324

Preservative

Lyophilized powder

AA Sequence

IYLNDQNLCIPASSSFVYGAVPIGASIYVIGDLDTGTNYDYVREFKRSTG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Thromboxane B2, TXB2 ELISA Kit
CSB-E08047r-01 48 Tests

Rat Thromboxane B2, TXB2 ELISA Kit

Sign In for Pricing
View Details
Rat Thromboxane B2, TXB2 ELISA Kit
CSB-E08047r-02 96 Tests

Rat Thromboxane B2, TXB2 ELISA Kit

Sign In for Pricing
View Details
Rat Thromboxane B2, TXB2 ELISA Kit
CSB-E08047r-03 5x 96 Tests

Rat Thromboxane B2, TXB2 ELISA Kit

Sign In for Pricing
View Details
Rat Thromboxane B2, TXB2 ELISA Kit
CSB-E08047r-04 10x 96 Tests

Rat Thromboxane B2, TXB2 ELISA Kit

Sign In for Pricing
View Details
Ankyrin-1 (8C3) HRP
sc-12733 HRP 200 µg/mL

Ankyrin-1 (8C3) HRP

Sign In for Pricing
View Details
Human Gs (Gelsolin) ELISA Kit
FY-EH5788 96 Well

Human Gs (Gelsolin) ELISA Kit

Sign In for Pricing
View Details