Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GANAB Peptide - middle region

GANAB Peptide - middle region

Product Specifications

Product Name Alternative

G2AN, GLUII, KIAA0088

UniProt

Q14697

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GANAB Rabbit Polyclonal Antibody (orb582923) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_938148

Preservative

Lyophilized powder

AA Sequence

IIGAGKPAAVVLQTKGSPESRLSFQHDPETSVLVLRKPGINVASDWSIHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR25 Human Gene Knockout Kit (CRISPR)
KN416049 1 Kit

WDR25 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mechanical Ultrasonic desktop cleaner BULC-405
BULC-405 1 Unit

Mechanical Ultrasonic desktop cleaner BULC-405

Sign In for Pricing
View Details
Nogo Receptor (RTN4R) (NM_023004) Human Recombinant Protein
TP720491M 50 µg

Nogo Receptor (RTN4R) (NM_023004) Human Recombinant Protein

Sign In for Pricing
View Details
LRRFIP2 (NM_001134369) Human Over-expression Lysate
LY427402 100 µg

LRRFIP2 (NM_001134369) Human Over-expression Lysate

Sign In for Pricing
View Details
AKIP (AURKAIP1) (NM_001127230) Human Over-expression Lysate
LC426729 20 µg

AKIP (AURKAIP1) (NM_001127230) Human Over-expression Lysate

Sign In for Pricing
View Details
Poliovirus Receptor (PVR) (NM_006505) Human Over-expression Lysate
LY401951 100 µg

Poliovirus Receptor (PVR) (NM_006505) Human Over-expression Lysate

Sign In for Pricing
View Details