Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GANAB Peptide - middle region

GANAB Peptide - middle region

Product Specifications

Product Name Alternative

G2AN, GLUII, KIAA0088

UniProt

Q14697

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GANAB Rabbit Polyclonal Antibody (orb582923) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_938148

Preservative

Lyophilized powder

AA Sequence

IIGAGKPAAVVLQTKGSPESRLSFQHDPETSVLVLRKPGINVASDWSIHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIK3 Human Gene Knockout Kit (CRISPR)
KN223406RB 1 Kit

SIK3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P57 / KIP2 (KIP2/880), CF594 conjugate, 0.1mg/mL
BNC940880-100 1x 100 µL

P57 / KIP2 (KIP2/880), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Rectum
CS708345 5x 5 µm

Tissue FFPE Sections, Rectum

Sign In for Pricing
View Details
N1,N12- Diacetylspermine Dihydrochloride
TRC-D367005-25MG 25 mg

N1,N12- Diacetylspermine Dihydrochloride

Sign In for Pricing
View Details
Fumonisin B2
TRC-F862755-5MG 5 mg

Fumonisin B2

Sign In for Pricing
View Details
BC051019 Mouse Gene Knockout Kit (CRISPR)
KN502052 1 Kit

BC051019 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details