Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gatad2b Peptide - C-terminal region

Gatad2b Peptide - C-terminal region

Product Specifications

Product Name Alternative

AL118180, C430014D17Rik, KIAA1150, P66beta, mKIAA1150

UniProt

Q8VHR5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gatad2b Rabbit Polyclonal Antibody (orb577111) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_647465

Preservative

Lyophilized powder

AA Sequence

LSNFAQAPQLSVPGGLLGMPGVNIAYLNTGIGGHKAPSLADRQREYLLDM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX1 (NM_005986) Human Over-expression Lysate
LY401812 100 µg

SOX1 (NM_005986) Human Over-expression Lysate

Sign In for Pricing
View Details
Nck (NCK1) Mouse Monoclonal Antibody [Clone ID: 5B7]
AM06766PU-N 100 µg

Nck (NCK1) Mouse Monoclonal Antibody [Clone ID: 5B7]

Sign In for Pricing
View Details
DPH2 Human Gene Knockout Kit (CRISPR)
KN201382BN 1 Kit

DPH2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TFIIF (GTF2F1) Rabbit Polyclonal Antibody
TA376849 100 µL

TFIIF (GTF2F1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
9-Chloro-dibenzo[b,f][1,4]thiazepin-11(10H)-one
TRC-C365278-25MG 25 mg

9-Chloro-dibenzo[b,f][1,4]thiazepin-11(10H)-one

Sign In for Pricing
View Details
Bak (BAK1) (NM_001188) Human Over-expression Lysate
LY400476 100 µg

Bak (BAK1) (NM_001188) Human Over-expression Lysate

Sign In for Pricing
View Details