Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gatad2b Peptide - C-terminal region

Gatad2b Peptide - C-terminal region

Product Specifications

Product Name Alternative

AL118180, C430014D17Rik, KIAA1150, P66beta, mKIAA1150

UniProt

Q8VHR5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gatad2b Rabbit Polyclonal Antibody (orb577111) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_647465

Preservative

Lyophilized powder

AA Sequence

LSNFAQAPQLSVPGGLLGMPGVNIAYLNTGIGGHKAPSLADRQREYLLDM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Netrin 1 (NTN1) Rabbit Polyclonal Antibody
AP05263PU-N 25 µg

Netrin 1 (NTN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZBBX Human Gene Knockout Kit (CRISPR)
KN418415 1 Kit

ZBBX Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
trans,trans-Farnesyl Chloride
TRC-F102510-1MG 1 mg

trans,trans-Farnesyl Chloride

Sign In for Pricing
View Details
Human VCAM-1/CD106 Antibody Pair Set
E-KAB-0456 50 µL & 100 µg

Human VCAM-1/CD106 Antibody Pair Set

Sign In for Pricing
View Details
Human Laminin Beta 3 (LAMb3) ELISA Kit
RD-LAMb3-Hu-01 96 Tests

Human Laminin Beta 3 (LAMb3) ELISA Kit

Sign In for Pricing
View Details
Human Laminin Beta 3 (LAMb3) ELISA Kit
RD-LAMb3-Hu-02 48 Tests

Human Laminin Beta 3 (LAMb3) ELISA Kit

Sign In for Pricing
View Details