Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBA Peptide - C-terminal region

GBA Peptide - C-terminal region

Product Specifications

Product Name Alternative

GBA1, GCB, GLUC

UniProt

P04062

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GBA Rabbit Polyclonal Antibody (orb584987) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000148

Preservative

Lyophilized powder

AA Sequence

EGSQRVGLVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HBA1 (Center) Rabbit Polyclonal Antibody
AP52006PU-N 200 µL

HBA1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SHC (SHC1) (NM_001130040) Human Over-expression Lysate
LC427121 20 µg

SHC (SHC1) (NM_001130040) Human Over-expression Lysate

Sign In for Pricing
View Details
Myb Rabbit Polyclonal Antibody
AP09406PU-N 100 µg

Myb Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MIR3973 Human qPCR Primer Pair (MI0016991)
HP300918 200 Reactions

MIR3973 Human qPCR Primer Pair (MI0016991)

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2557R), CF594 conjugate, 0.1mg/mL
BNC942557-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2557R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) (rPTPRC/1132), CF640R conjugate, 0.1mg/mL
BNC403461-100 1x 100 µL

CD45RB (B-Cell Marker) (rPTPRC/1132), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details