Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBA Peptide - C-terminal region

GBA Peptide - C-terminal region

Product Specifications

Product Name Alternative

GBA1, GCB, GLUC

UniProt

P04062

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GBA Rabbit Polyclonal Antibody (orb584987) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000148

Preservative

Lyophilized powder

AA Sequence

EGSQRVGLVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isobornyl Acrylate (stabilized with MeHQ)
TRC-I779128-250MG 250 mg

Isobornyl Acrylate (stabilized with MeHQ)

Sign In for Pricing
View Details
R,R-Phytantriol-d6 (Major)
TRC-P120011-10MG 10 mg

R,R-Phytantriol-d6 (Major)

Sign In for Pricing
View Details
EAPP Human Gene Knockout Kit (CRISPR)
KN401501 1 Kit

EAPP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Glucocorticoid Receptor (NR3C1) Human Knockdown Lysate
LY300380 100 µg

Glucocorticoid Receptor (NR3C1) Human Knockdown Lysate

Sign In for Pricing
View Details
Acetoin (~90%)
TRC-A163778-5G 5 g

Acetoin (~90%)

Sign In for Pricing
View Details
IDE Human Gene Knockout Kit (CRISPR)
KN420700 1 Kit

IDE Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details