GBL Peptide - middle region
GBL Peptide - middle region
Product Specifications
Product Name Alternative
MGC111011, GBL, LST8, POP3, WAT1, GbetaL
UniProt
Q9BVC4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GBL Rabbit Polyclonal Antibody (orb583645) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_071767
Preservative
Lyophilized powder
AA Sequence
CAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
C2405-14A-APC 100 µL
CD51 (Integrin alphaV, Vitronectin alpha Subunit Receptor, VNR) (APC)
Sign In for Pricing
View Details 
PKSH034033-01 20 µg
Recombinant Human Interleukin-13/IL-13 (C-Avi-6His) Biotinylated
Sign In for Pricing
View Details PKSH034033-02 100 µg
Recombinant Human Interleukin-13/IL-13 (C-Avi-6His) Biotinylated
Sign In for Pricing
View Details 