Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBP2 Peptide - N-terminal region

GBP2 Peptide - N-terminal region

Product Specifications

UniProt

P32456

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GBP2 Rabbit Polyclonal Antibody (orb582449) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004111

Preservative

Lyophilized powder

AA Sequence

HYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNAZ (NM_002073) Human Over-expression Lysate
LC400764 20 µg

GNAZ (NM_002073) Human Over-expression Lysate

Sign In for Pricing
View Details
PSMG2 Mouse Monoclonal Antibody [Clone ID: OTI3F1]
CF808501 100 µg

PSMG2 Mouse Monoclonal Antibody [Clone ID: OTI3F1]

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (C31/2876R), CF640R conjugate, 0.1mg/mL
BNC402876-500 1x 500 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (C31/2876R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD101 Antibody[BB27]
E-AB-F1361J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD101 Antibody[BB27]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD101 Antibody[BB27]
E-AB-F1361J-02 100 Tests

PerCP/Cyanine5.5 Anti-Human CD101 Antibody[BB27]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD101 Antibody[BB27]
E-AB-F1361J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Human CD101 Antibody[BB27]

Sign In for Pricing
View Details