Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBP3 Peptide - N-terminal region

GBP3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686E0974, DKFZp686L15228, FLJ10961

UniProt

Q9H0R5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GBP3 Rabbit Polyclonal Antibody (orb585246) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060754

Preservative

Lyophilized powder

AA Sequence

MDQLYYVTELTHRIRSKSSPDENENEDSADFVSFFPDFVWTLRDFSLDLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EMPA
TRC-E521550-50MG 50 mg

EMPA

Sign In for Pricing
View Details
Kcnmb4 Mouse Monoclonal Antibody [Clone ID: L18A/3]
75-086 100 µL

Kcnmb4 Mouse Monoclonal Antibody [Clone ID: L18A/3]

Sign In for Pricing
View Details
MAGEA8 Human Gene Knockout Kit (CRISPR)
KN200670RB 1 Kit

MAGEA8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MAGEB18 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H2]
TA502633AM 100 µL

MAGEB18 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H2]

Sign In for Pricing
View Details
IDN3 (NIPBL) (889-902) Goat Polyclonal Antibody
AP23654PU-N 100 µg

IDN3 (NIPBL) (889-902) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Tabalumab Biosimilar - Dylight488 Research Grade
ICH5103D488-0.1mg 100 µg

Tabalumab Biosimilar - Dylight488 Research Grade

Sign In for Pricing
View Details