Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gcat Peptide - C-terminal region

Gcat Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI526977, Kbl

UniProt

E9PWY6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gcat Rabbit Polyclonal Antibody (orb580512) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001155184

Preservative

Lyophilized powder

AA Sequence

AQYGALVFVDECHATGFLGPTGRGTDELLGVMDQVTIINSTLGKALGGAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSDE1 (NM_007158) Human Recombinant Protein
TP307101M 100 µg

CSDE1 (NM_007158) Human Recombinant Protein

Sign In for Pricing
View Details
3-(9H-Carbazol-9-yl)propanoic Acid
TRC-H956178-250MG 250 mg

3-(9H-Carbazol-9-yl)propanoic Acid

Sign In for Pricing
View Details
Thymidylate Synthase (TMS715), CF405S conjugate, 0.1mg/mL
BNC040715-100 1x 100 µL

Thymidylate Synthase (TMS715), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Urinary Indican Test Kit
I1000N 20 Tests

Urinary Indican Test Kit

Sign In for Pricing
View Details
Chicken C Reactive Protein (CRP) ELISA Kit
RDR-CRP-Ch-01 96 Tests

Chicken C Reactive Protein (CRP) ELISA Kit

Sign In for Pricing
View Details
Chicken C Reactive Protein (CRP) ELISA Kit
RDR-CRP-Ch-02 48 Tests

Chicken C Reactive Protein (CRP) ELISA Kit

Sign In for Pricing
View Details