Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gcat Peptide - C-terminal region

Gcat Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI526977, Kbl

UniProt

E9PWY6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gcat Rabbit Polyclonal Antibody (orb580512) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001155184

Preservative

Lyophilized powder

AA Sequence

AQYGALVFVDECHATGFLGPTGRGTDELLGVMDQVTIINSTLGKALGGAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Boc-Glu(OBzl)-OH
TRC-B391800-5G 5 g

Boc-Glu(OBzl)-OH

Sign In for Pricing
View Details
1,3-Diaminopropane Dihydrochloride (Low water content)
TRC-D417695-5G 5 g

1,3-Diaminopropane Dihydrochloride (Low water content)

Sign In for Pricing
View Details
Human Kappa Light Chain (L1C1), CF488A conjugate, 0.1mg/mL
BNC880018-500 1x 500 µL

Human Kappa Light Chain (L1C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ccdc73 Mouse Gene Knockout Kit (CRISPR)
KN502743 1 Kit

Ccdc73 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MEK6 (MAP2K6) Rabbit Polyclonal Antibody
AP06223PU-N 100 µg

MEK6 (MAP2K6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Calponin (CNN1) Rabbit Polyclonal Antibody
TA374921 100 µL

Calponin (CNN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details