Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gcdh Peptide - C-terminal region

Gcdh Peptide - C-terminal region

Product Specifications

Product Name Alternative

Gcdh

UniProt

D3ZT90

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gcdh Rabbit Polyclonal Antibody (orb578871) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001102366

Preservative

Lyophilized powder

AA Sequence

LQLGRLKDQDKATPEMVSLLKRNNCGKALDIARQARDILGGNGISDEYHV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr814 (NM_207159) Mouse Tagged ORF Clone
MG213200 10 µg

Olfr814 (NM_207159) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Thymidylate Synthase Antibody
E51A07167 100 µL

Thymidylate Synthase Antibody

Sign In for Pricing
View Details
[KO Validated] CD44 Rabbit pAb
E45R19041N 50 ul

[KO Validated] CD44 Rabbit pAb

Sign In for Pricing
View Details
YggX Antibody
orb814579 2 mg

YggX Antibody

Sign In for Pricing
View Details
TPD52L1 Antibody (N-term)
MBS9212809-01 0.08 mL

TPD52L1 Antibody (N-term)

Sign In for Pricing
View Details
TPD52L1 Antibody (N-term)
MBS9212809-02 0.4 mL

TPD52L1 Antibody (N-term)

Sign In for Pricing
View Details