Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gcm1 Peptide - N-terminal region

Gcm1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GCMa, Gcm-rs2, Gcm1-rs1, glide

UniProt

P70348

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gcm1 Rabbit Polyclonal Antibody (orb324668) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032129

Preservative

Lyophilized powder

AA Sequence

KEILSWDINDVKLPQNVKTTDWFQEWPDSYVKHIYSSDDRNAQRHLSSWA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSA Sorbent
TRC-P839905-5G 5 g

PSA Sorbent

Sign In for Pricing
View Details
KCNK10 (NM_138317) Human Over-expression Lysate
LC403348 20 µg

KCNK10 (NM_138317) Human Over-expression Lysate

Sign In for Pricing
View Details
1,4-Phenylenediamine-d4
TRC-P319847-10MG 10 mg

1,4-Phenylenediamine-d4

Sign In for Pricing
View Details
Mouse Olfr49 activation kit by CRISPRa
GA203030 1 Kit

Mouse Olfr49 activation kit by CRISPRa

Sign In for Pricing
View Details
PHACS (ACCS) (NM_001127219) Human Over-expression Lysate
LY426720 100 µg

PHACS (ACCS) (NM_001127219) Human Over-expression Lysate

Sign In for Pricing
View Details
Human KLF16 activation kit by CRISPRa
GA113276 1 Kit

Human KLF16 activation kit by CRISPRa

Sign In for Pricing
View Details