Gcm1 Peptide - N-terminal region
Gcm1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
GCMa, Gcm-rs2, Gcm1-rs1, glide
UniProt
P70348
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Gcm1 Rabbit Polyclonal Antibody (orb324668) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_032129
Preservative
Lyophilized powder
AA Sequence
KEILSWDINDVKLPQNVKTTDWFQEWPDSYVKHIYSSDDRNAQRHLSSWA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![UCHL5IP (HAUS7) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G1]](https://cdn.genprice.uk/products/937/68dd1b72061270361ea190a6/imageurl/ta507056am.webp)
TA507056AM 100 µL
UCHL5IP (HAUS7) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G1]
Sign In for Pricing
View Details ![Nogo Receptor Recombinant Rabbit Monoclonal Antibody [JE33-68]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea80f19/imageurl/ha722391.webp)
HA722391 100 µL
Nogo Receptor Recombinant Rabbit Monoclonal Antibody [JE33-68]
Sign In for Pricing
View Details 
AP17626PU-N 400 µL
ERp57 (PDIA3) (Center) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
BNCB3526-100 1x 100 µL
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3526), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details