Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDAP2 Peptide - N-terminal region

GDAP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ20142, dJ776P7.1, MACROD3

UniProt

Q9NXN4

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GDAP2 Rabbit Polyclonal Antibody (orb583407) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060156

Preservative

Lyophilized powder

AA Sequence

CRTGEAKLTKGFNLAARFIIHTVGPKYKSRYRTAAESSLYSCYRNVLQLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Early endosome antigen 1 (EEA1) ELISA Kit
AE46165MO-01 48 Tests

Mouse Early endosome antigen 1 (EEA1) ELISA Kit

Sign In for Pricing
View Details
Mouse Early endosome antigen 1 (EEA1) ELISA Kit
AE46165MO-02 96 Tests

Mouse Early endosome antigen 1 (EEA1) ELISA Kit

Sign In for Pricing
View Details
FITC Anti-Mouse CD14 Antibody[Sa14-2]
FCE3106-01 50 Tests

FITC Anti-Mouse CD14 Antibody[Sa14-2]

Sign In for Pricing
View Details
FITC Anti-Mouse CD14 Antibody[Sa14-2]
FCE3106-02 100 Tests

FITC Anti-Mouse CD14 Antibody[Sa14-2]

Sign In for Pricing
View Details
FITC Anti-Mouse CD14 Antibody[Sa14-2]
FCE3106-03 2x 100 Tests

FITC Anti-Mouse CD14 Antibody[Sa14-2]

Sign In for Pricing
View Details
Dysf (NM_021469) Mouse Recombinant Protein
PM42844M5 20 µg

Dysf (NM_021469) Mouse Recombinant Protein

Sign In for Pricing
View Details