Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDAP2 Peptide - N-terminal region

GDAP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ20142, dJ776P7.1, MACROD3

UniProt

Q9NXN4

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GDAP2 Rabbit Polyclonal Antibody (orb583407) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060156

Preservative

Lyophilized powder

AA Sequence

CRTGEAKLTKGFNLAARFIIHTVGPKYKSRYRTAAESSLYSCYRNVLQLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rno-miR-3568 miRNA Antagomir
CIS0615-01 10 nmol

Rno-miR-3568 miRNA Antagomir

Sign In for Pricing
View Details
Rno-miR-3568 miRNA Antagomir
CIS0615-02 20 nmol

Rno-miR-3568 miRNA Antagomir

Sign In for Pricing
View Details
4- (1-bromoethyl) -1,2-difluorobenzene
sc-347540 250 mg

4- (1-bromoethyl) -1,2-difluorobenzene

Sign In for Pricing
View Details
BTNL8 ORF Vector (Human) (pORF)
ORF012358 1.0 µg DNA

BTNL8 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
ZADH2 Double Nickase Plasmid (h2)
sc-408358-NIC-2 20 µg

ZADH2 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Recombinant Human ELMO2 Protein, N-His
AP92725 50 µg

Recombinant Human ELMO2 Protein, N-His

Sign In for Pricing
View Details