Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gdf10 Peptide - middle region

Gdf10 Peptide - middle region

Product Specifications

Product Name Alternative

Anks1a, mKIAA0229

UniProt

P59672

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gdf10 Rabbit Polyclonal Antibody (orb582458) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_852078

Preservative

Lyophilized powder

AA Sequence

RYDPFPAGDFEPGAAPNSSADPRVRRAAQVSKPLQDNELPGLDERPAPAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD41 (ITGA2B) (NM_000419) Human Over-expression Lysate
LY424734 100 µg

CD41 (ITGA2B) (NM_000419) Human Over-expression Lysate

Sign In for Pricing
View Details
S-(+)-Mecamylamine Hydrochloride
TRC-M202595-10MG 10 mg

S-(+)-Mecamylamine Hydrochloride

Sign In for Pricing
View Details
HEATR7A (MROH1) (NM_001099281) Human Recombinant Protein
TP313352M 100 µg

HEATR7A (MROH1) (NM_001099281) Human Recombinant Protein

Sign In for Pricing
View Details
Cardboard Freezer Boxes
R2700-A 5 Units/Pack

Cardboard Freezer Boxes

Sign In for Pricing
View Details
Sike1 Mouse Gene Knockout Kit (CRISPR)
KN515787 1 Kit

Sike1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FNBP3 (PRPF40A) Rabbit Polyclonal Antibody
TA361584 100 µL

FNBP3 (PRPF40A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details