Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gdf10 Peptide - middle region

Gdf10 Peptide - middle region

Product Specifications

Product Name Alternative

Anks1a, mKIAA0229

UniProt

P59672

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gdf10 Rabbit Polyclonal Antibody (orb582458) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_852078

Preservative

Lyophilized powder

AA Sequence

RYDPFPAGDFEPGAAPNSSADPRVRRAAQVSKPLQDNELPGLDERPAPAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFDP3 Human Gene Knockout Kit (CRISPR)
KN419344 1 Kit

TFDP3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ECHDC3 (NM_024693) Human Recombinant Protein
TP303685L 1 mg

ECHDC3 (NM_024693) Human Recombinant Protein

Sign In for Pricing
View Details
Myosin Light Chain 2 (MYL2) (1-166) Mouse Monoclonal Antibody [Clone ID: AT3B2]
AM09080PU-S 50 µL

Myosin Light Chain 2 (MYL2) (1-166) Mouse Monoclonal Antibody [Clone ID: AT3B2]

Sign In for Pricing
View Details
Anxa3 Mouse Gene Knockout Kit (CRISPR)
KN501335 1 Kit

Anxa3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RBM34 (NM_015014) Human Over-expression Lysate
LC402401 20 µg

RBM34 (NM_015014) Human Over-expression Lysate

Sign In for Pricing
View Details
VAT1 (NM_006373) Human Over-expression Lysate
LC401915 20 µg

VAT1 (NM_006373) Human Over-expression Lysate

Sign In for Pricing
View Details