Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GEMIN6 Peptide - middle region

GEMIN6 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ23459

UniProt

Q8WXD5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GEMIN6 Rabbit Polyclonal Antibody (orb326410) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079051

Preservative

Lyophilized powder

AA Sequence

GHAVQTVETMNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chitinase 3 like protein 2 Antibody Blocking Peptide
orb1512847 500 µg

Chitinase 3 like protein 2 Antibody Blocking Peptide

Sign In for Pricing
View Details
Lentiviral human THOC3 shRNA (UAS) - Lentiviral human THOC3 shRNA (UAS, GFP) plasmid
GTR15118114 1 Vial

Lentiviral human THOC3 shRNA (UAS) - Lentiviral human THOC3 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
OAS1 Rabbit Polyclonal Antibody
orb412113-01 30 µL

OAS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OAS1 Rabbit Polyclonal Antibody
orb412113-02 50 μL

OAS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OAS1 Rabbit Polyclonal Antibody
orb412113-03 100 µL

OAS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OAS1 Rabbit Polyclonal Antibody
orb412113-04 200 µL

OAS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details