Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GHDC Peptide - N-terminal region

GHDC Peptide - N-terminal region

Product Specifications

Product Name Alternative

D11LGP1, LGP1

UniProt

B3KVB0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GHDC Rabbit Polyclonal Antibody (orb585269) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001136095

Preservative

Lyophilized powder

AA Sequence

LRWCLQGAQRPHCSLRRSTDISTFRNHLPLTKASQTQQEDSGEQPLPPTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Baricitinib phosphate
C11317-25mg 25 mg

Baricitinib phosphate

Sign In for Pricing
View Details
Anti-Human CD33 Antibody (SAA1404), APC
MBS1583608-01 50 Tests

Anti-Human CD33 Antibody (SAA1404), APC

Sign In for Pricing
View Details
Anti-Human CD33 Antibody (SAA1404), APC
MBS1583608-02 100 Tests

Anti-Human CD33 Antibody (SAA1404), APC

Sign In for Pricing
View Details
Anti-Human CD33 Antibody (SAA1404), APC
MBS1583608-03 5x 100 Tests

Anti-Human CD33 Antibody (SAA1404), APC

Sign In for Pricing
View Details
SEC24C Polyclonal Antibody
A72206-050 50 µL

SEC24C Polyclonal Antibody

Sign In for Pricing
View Details
KERA Protein Vector (Human) (pPB-N-His)
PV022330 500 ng

KERA Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details