Ghitm Peptide - middle region
Ghitm Peptide - middle region
Product Specifications
Product Name Alternative
1010001P14Rik, C77840, PTD010, MICS1
UniProt
Q91VC9
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ghitm Rabbit Polyclonal Antibody (orb579935) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_510963
Preservative
Lyophilized powder
AA Sequence
WVTIGATFAAMIGAGMLVHSISYEQSPGPKHLAWMLHSGVMGAVVAPLTI
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15378450 1 Vial
Lentiviral human NRG3 sgRNA gene knockout kit - Lentiviral human NRG3 sgRNA gene knockout kit (25)
Sign In for Pricing
View Details ![Peripherin (PRPH) Mouse Monoclonal Antibody [Clone ID: OTI7E4]](https://cdn.genprice.uk/products/937/68dd18b9061270361e907e8f/imageurl/cf806226.webp)
CF806226 100 µg
Peripherin (PRPH) Mouse Monoclonal Antibody [Clone ID: OTI7E4]
Sign In for Pricing
View Details 
