Ghitm Peptide - middle region
Ghitm Peptide - middle region
Product Specifications
Product Name Alternative
1010001P14Rik, C77840, PTD010, MICS1
UniProt
Q91VC9
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ghitm Rabbit Polyclonal Antibody (orb579935) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_510963
Preservative
Lyophilized powder
AA Sequence
WVTIGATFAAMIGAGMLVHSISYEQSPGPKHLAWMLHSGVMGAVVAPLTI
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Anti-IL15RA Mouse Monoclonal Antibody [Clone ID: OTI3D5]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
M03016 100 µL
Anti-IL15RA Mouse Monoclonal Antibody [Clone ID: OTI3D5]
Sign In for Pricing
View Details 
GTR15396923 1 Vial
Lentiviral human ABCD4 sgRNA gene knockout kit - Lentiviral human ABCD4 sgRNA gene knockout kit (plasmid)
Sign In for Pricing
View Details 
50524151 3x 1.0 µg DNA
XKR4 CRISPR All-in-one AAV vector set (with saCas9)(Human)
Sign In for Pricing
View Details K1007205 3x 1.0 µg
HVBS4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details NBP3-24158MFV500 0.1 mL
Rabbit Monoclonal Cadherin-16 Antibody (CDH16/8800R) [mFluor Violet 500 SE]
Sign In for Pricing
View Details