Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GHSR Peptide - C-terminal region

GHSR Peptide - C-terminal region

Product Specifications

UniProt

B3SXS8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GHSR Rabbit Polyclonal Antibody (orb585712) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_940799

Preservative

Lyophilized powder

AA Sequence

AAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWTESSIN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDM2B (NM_001005366) Human Over-expression Lysate
LC423701 20 µg

KDM2B (NM_001005366) Human Over-expression Lysate

Sign In for Pricing
View Details
CCNQ (NM_152274) Human Recombinant Protein
TP761792 50 µg

CCNQ (NM_152274) Human Recombinant Protein

Sign In for Pricing
View Details
Water Chiller BCHI-211
BCHI-211 Each

Water Chiller BCHI-211

Sign In for Pricing
View Details
MGMT Mouse Monoclonal Antibody [Clone ID: OTI17H4]
CF809255 100 µg

MGMT Mouse Monoclonal Antibody [Clone ID: OTI17H4]

Sign In for Pricing
View Details
P21WAF1 (Tumor Suppressor Protein) (AC8), CF740 conjugate, 0.1mg/mL
BNC742378-500 1x 500 µL

P21WAF1 (Tumor Suppressor Protein) (AC8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DPP8 (NM_197961) Human Over-expression Lysate
LY403668 100 µg

DPP8 (NM_197961) Human Over-expression Lysate

Sign In for Pricing
View Details