Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GHSR Peptide - C-terminal region

GHSR Peptide - C-terminal region

Product Specifications

UniProt

Q92847

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GHSR Rabbit Polyclonal Antibody (orb585713) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_940799

Preservative

Lyophilized powder

AA Sequence

RKLWRRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK20 Polyclonal Antibody
E-AB-90272-01 60 µL

CDK20 Polyclonal Antibody

Sign In for Pricing
View Details
CDK20 Polyclonal Antibody
E-AB-90272-02 120 µL

CDK20 Polyclonal Antibody

Sign In for Pricing
View Details
CDK20 Polyclonal Antibody
E-AB-90272-03 200 µL

CDK20 Polyclonal Antibody

Sign In for Pricing
View Details
Cinnabarinic Acid
TRC-C442000-5MG 5 mg

Cinnabarinic Acid

Sign In for Pricing
View Details
CTNNA1 Polyclonal Antibody
E-AB-10207-01 20 µL

CTNNA1 Polyclonal Antibody

Sign In for Pricing
View Details
CTNNA1 Polyclonal Antibody
E-AB-10207-02 60 µL

CTNNA1 Polyclonal Antibody

Sign In for Pricing
View Details