Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GHSR Peptide - C-terminal region

GHSR Peptide - C-terminal region

Product Specifications

UniProt

Q92847

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GHSR Rabbit Polyclonal Antibody (orb585713) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_940799

Preservative

Lyophilized powder

AA Sequence

RKLWRRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3283), CF568 conjugate, 0.1mg/mL
BNC683283-100 1x 100 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3283), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ITIH2 (NM_002216) Human Recombinant Protein
TP324384L 1 mg

ITIH2 (NM_002216) Human Recombinant Protein

Sign In for Pricing
View Details
Elab Fluor® Red 780 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09843S-01 25 µg

Elab Fluor® Red 780 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Rat IgG2b, κ Isotype Control[LTF-2]
E-AB-F09843S-02 100 µg

Elab Fluor® Red 780 Rat IgG2b, κ Isotype Control[LTF-2]

Sign In for Pricing
View Details
CREB3L1 Human Gene Knockout Kit (CRISPR)
KN204968LP 1 Kit

CREB3L1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
WASP (WAS) (NM_000377) Human Over-expression Lysate
LC424761 20 µg

WASP (WAS) (NM_000377) Human Over-expression Lysate

Sign In for Pricing
View Details