Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIMAP6 Peptide - C-terminal region

GIMAP6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp686A01175, FLJ22690, IAN6, hIAN2, IAN2, IAN-2, IAN-6

UniProt

Q6P9H5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GIMAP6 Rabbit Polyclonal Antibody (orb583044) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078987

Preservative

Lyophilized powder

AA Sequence

GVGVLGHTILVFTRKEDLAGGSLEDYVRETNNQALAWLDVTLARRHCGFN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Epb41l3 activation kit by CRISPRa
GA201252 1 Kit

Mouse Epb41l3 activation kit by CRISPRa

Sign In for Pricing
View Details
Human LINGO3 activation kit by CRISPRa
GA118754 1 Kit

Human LINGO3 activation kit by CRISPRa

Sign In for Pricing
View Details
3-Chlorobenzoyl Cyanide
TRC-C651790-10MG 10 mg

3-Chlorobenzoyl Cyanide

Sign In for Pricing
View Details
Bco1 Mouse Gene Knockout Kit (CRISPR)
KN502118 1 Kit

Bco1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SMARCD2 (NM_001098426) Human Over-expression Lysate
LY420583 100 µg

SMARCD2 (NM_001098426) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Phospho-NF-κB p65 (Ser536) Monoclonal Antibody
AN300381L-01 20 µL

Recombinant Phospho-NF-κB p65 (Ser536) Monoclonal Antibody

Sign In for Pricing
View Details