Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIMAP6 Peptide - C-terminal region

GIMAP6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp686A01175, FLJ22690, IAN6, hIAN2, IAN2, IAN-2, IAN-6

UniProt

Q6P9H5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GIMAP6 Rabbit Polyclonal Antibody (orb583044) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078987

Preservative

Lyophilized powder

AA Sequence

GVGVLGHTILVFTRKEDLAGGSLEDYVRETNNQALAWLDVTLARRHCGFN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(Morpholinoethyl)acrylamide
TRC-M732950-250MG 250 mg

2-(Morpholinoethyl)acrylamide

Sign In for Pricing
View Details
Cd3g (NM_009850) Mouse Tagged ORF Clone
MG201641 10 µg

Cd3g (NM_009850) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Clusterin Polyclonal Antibody
AN005940L-01 25 µL

Clusterin Polyclonal Antibody

Sign In for Pricing
View Details
Clusterin Polyclonal Antibody
AN005940L-02 100 µL

Clusterin Polyclonal Antibody

Sign In for Pricing
View Details
Human Antizyme inhibitor 1 (AZIN1) activation kit by CRISPRa
GA109885 1 Kit

Human Antizyme inhibitor 1 (AZIN1) activation kit by CRISPRa

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD36 Antibody[5-271]
E-AB-F1164M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD36 Antibody[5-271]

Sign In for Pricing
View Details