Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIT2 Peptide - C-terminal region

GIT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CAT-2, DKFZp686G01261, KIAA0148, MGC760, CAT2

UniProt

Q14161

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GIT2 Rabbit Polyclonal Antibody (orb585079) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_476510

Preservative

Lyophilized powder

AA Sequence

VQTGSEYTDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPMGEASRPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Xenopus laevis Transmembrane protein 184C (tmem184c)
MBS7031639-01 0.02 mg

Recombinant Xenopus laevis Transmembrane protein 184C (tmem184c)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Transmembrane protein 184C (tmem184c)
MBS7031639-02 0.1 mg

Recombinant Xenopus laevis Transmembrane protein 184C (tmem184c)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Transmembrane protein 184C (tmem184c)
MBS7031639-03 5x 0.1 mg

Recombinant Xenopus laevis Transmembrane protein 184C (tmem184c)

Sign In for Pricing
View Details
CEP152 Rabbit Polyclonal Antibody
APRab08659-01 20 µL

CEP152 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CEP152 Rabbit Polyclonal Antibody
APRab08659-02 50 µL

CEP152 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CEP152 Rabbit Polyclonal Antibody
APRab08659-03 100 µL

CEP152 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details