GIT2 Peptide - C-terminal region
GIT2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CAT-2, DKFZp686G01261, KIAA0148, MGC760, CAT2
UniProt
Q14161
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GIT2 Rabbit Polyclonal Antibody (orb585079) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_476510
Preservative
Lyophilized powder
AA Sequence
VQTGSEYTDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPMGEASRPE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
9-33021 Set
Mouse Breast PrimaCell™: Normal Mammary Epithelial Primary Cells Growth Supplements with Serum (for 500 mL medium)
Sign In for Pricing
View Details MBS6448975-01 0.1 mL
RFFL (Ring Finger And FYVE-Like Domain Containing E3 Ubiquitin Protein Ligase, CARP2, FRING, CARP-2, RNF189, RNF34L, RIFIFYLIN) (MaxLight 650)
Sign In for Pricing
View Details MBS6448975-02 5x 0.1 mL
RFFL (Ring Finger And FYVE-Like Domain Containing E3 Ubiquitin Protein Ligase, CARP2, FRING, CARP-2, RNF189, RNF34L, RIFIFYLIN) (MaxLight 650)
Sign In for Pricing
View Details MBS6373505-01 0.1 mL
CDH3 (Cadherin 3, Cadherin-3, Placental Cadherin, P-cadherin, CDHP) (MaxLight 490)
Sign In for Pricing
View Details