Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gja8 Peptide - N-terminal region

Gja8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Aey5, Cnx50, Cx50, Lop10

UniProt

P28236

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gja8 Rabbit Polyclonal Antibody (orb578612) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032149

Preservative

Lyophilized powder

AA Sequence

MGDWSFLGNILEEVNEHSTVIGRVWLTVLFIFRILILGTAAEFVWGDEQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant TAOK1 (phospho S181) /TAOK2 (phospho S181) /TAOK3 (phospho S177) Antibody
RC-16642-01 50 μL

Recombinant TAOK1 (phospho S181) /TAOK2 (phospho S181) /TAOK3 (phospho S177) Antibody

Sign In for Pricing
View Details
Recombinant TAOK1 (phospho S181) /TAOK2 (phospho S181) /TAOK3 (phospho S177) Antibody
RC-16642-02 100 µL

Recombinant TAOK1 (phospho S181) /TAOK2 (phospho S181) /TAOK3 (phospho S177) Antibody

Sign In for Pricing
View Details
Recombinant TAOK1 (phospho S181) /TAOK2 (phospho S181) /TAOK3 (phospho S177) Antibody
RC-16642-03 1 mL

Recombinant TAOK1 (phospho S181) /TAOK2 (phospho S181) /TAOK3 (phospho S177) Antibody

Sign In for Pricing
View Details
Gelsolin (GSN) (NM_000177) Human Over-expression Lysate
LY424875 100 µg

Gelsolin (GSN) (NM_000177) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant P2RY13 Antibody
RC-5849-01 50 μL

Recombinant P2RY13 Antibody

Sign In for Pricing
View Details
Recombinant P2RY13 Antibody
RC-5849-02 100 µL

Recombinant P2RY13 Antibody

Sign In for Pricing
View Details