Gja8 Peptide - N-terminal region
Gja8 Peptide - N-terminal region
Product Specifications
Product Name Alternative
Aey5, Cnx50, Cx50, Lop10
UniProt
P28236
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Gja8 Rabbit Polyclonal Antibody (orb578612) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_032149
Preservative
Lyophilized powder
AA Sequence
MGDWSFLGNILEEVNEHSTVIGRVWLTVLFIFRILILGTAAEFVWGDEQS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040304-100 1x 100 µL
CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401820-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472980-100 1x 100 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2980R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details