GJC3 Peptide - middle region
GJC3 Peptide - middle region
Product Specifications
Product Name Alternative
CX29, CX30.2, CX31.3, GJE1
UniProt
Q8NFK1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GJC3 Rabbit Polyclonal Antibody (orb576041) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_853516
Preservative
Lyophilized powder
AA Sequence
WHWELSGKGKEEETLIQGREGNTDVPGAGSLRLLWAYVAQLGARLVLEGAA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC742885-500 1x 500 µL
CD81 / TAPA-1 (C81/2885R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-P991550-500MG 500 mg
2-Pyridinesulfonyl Chloride, Technical Grade
Sign In for Pricing
View Details 
BNUB1813-500 1x 500 µL
MTAP (Tumor Suppressor Marker) (MTAP/1813), 0.2mg/mL
Sign In for Pricing
View Details 