Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GJC3 Peptide - middle region

GJC3 Peptide - middle region

Product Specifications

Product Name Alternative

CX29, CX30.2, CX31.3, GJE1

UniProt

Q8NFK1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GJC3 Rabbit Polyclonal Antibody (orb576041) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_853516

Preservative

Lyophilized powder

AA Sequence

WHWELSGKGKEEETLIQGREGNTDVPGAGSLRLLWAYVAQLGARLVLEGAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Copper (Cu) Colorimetric Assay Kit
E-BC-K300-M-01 48 T (32 samples)

Copper (Cu) Colorimetric Assay Kit

Sign In for Pricing
View Details
Copper (Cu) Colorimetric Assay Kit
E-BC-K300-M-02 96 T (80 samples)

Copper (Cu) Colorimetric Assay Kit

Sign In for Pricing
View Details
Phospho-LC3A Antibody (pS12)
F48800-0.08ML 0.08 mL

Phospho-LC3A Antibody (pS12)

Sign In for Pricing
View Details
ARF4 (NM_001660) Human Over-expression Lysate
LC400627 20 µg

ARF4 (NM_001660) Human Over-expression Lysate

Sign In for Pricing
View Details
Tryptophanyl tRNA synthetase/WRS Antibody
OC-1294-01 50 μL

Tryptophanyl tRNA synthetase/WRS Antibody

Sign In for Pricing
View Details
Tryptophanyl tRNA synthetase/WRS Antibody
OC-1294-02 100 µL

Tryptophanyl tRNA synthetase/WRS Antibody

Sign In for Pricing
View Details