Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GK Peptide - middle region

GK Peptide - middle region

Product Specifications

Product Name Alternative

GK1, GKD

UniProt

A6NJP5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GK Rabbit Polyclonal Antibody (orb582953) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_976325

Preservative

Lyophilized powder

AA Sequence

MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINB1 (Leukocyte Elastase Inhibitor, LEI, Monocyte/Neutrophil Elastase Inhibitor, EI, M/NEI, Peptidase Inhibitor 2, PI-2, Serpin B1, ELANH2, MNEI, PI2) (PE)
133170-PE 100 µL

SERPINB1 (Leukocyte Elastase Inhibitor, LEI, Monocyte/Neutrophil Elastase Inhibitor, EI, M/NEI, Peptidase Inhibitor 2, PI-2, Serpin B1, ELANH2, MNEI, PI2) (PE)

Sign In for Pricing
View Details
Rabbit Polyclonal Aquaporin-11 Antibody
NBP3-25280 100 µL

Rabbit Polyclonal Aquaporin-11 Antibody

Sign In for Pricing
View Details
KAT6B Polyclonal Conjugated Antibody
MBS9441156-01 0.1 mL (Biotin)

KAT6B Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
KAT6B Polyclonal Conjugated Antibody
MBS9441156-02 0.1 mL (AF350)

KAT6B Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
KAT6B Polyclonal Conjugated Antibody
MBS9441156-03 0.1 mL (AF405)

KAT6B Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
KAT6B Polyclonal Conjugated Antibody
MBS9441156-04 0.1 mL (AF488)

KAT6B Polyclonal Conjugated Antibody

Sign In for Pricing
View Details