Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GK Peptide - middle region

GK Peptide - middle region

Product Specifications

Product Name Alternative

GK1, GKD

UniProt

A6NJP5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GK Rabbit Polyclonal Antibody (orb582953) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_976325

Preservative

Lyophilized powder

AA Sequence

MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DBNL Recombinant Protein (Rat)
RP197375 100 µg

DBNL Recombinant Protein (Rat)

Sign In for Pricing
View Details
Bulk Anti-Human CD28 (CD28.2) Antibody
ICH1013-100mg 100 mg

Bulk Anti-Human CD28 (CD28.2) Antibody

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Probable intracellular septation protein A (VC_1700), partial
MBS7098429 Inquire

Recombinant Vibrio cholerae serotype O1 Probable intracellular septation protein A (VC_1700), partial

Sign In for Pricing
View Details
SLC25A42 Rabbit Polyclonal Antibody
orb579069 100 µL

SLC25A42 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Potassium Acetate Solution 3 M pH 5.2
BU-107 100 mL

Potassium Acetate Solution 3 M pH 5.2

Sign In for Pricing
View Details
ALOX5AP, ID (Arachidonate 5-lipoxygenase-activating protein, FLAP, MK-886-binding Protein) (MaxLight 650)
MBS6462520-01 0.1 mL

ALOX5AP, ID (Arachidonate 5-lipoxygenase-activating protein, FLAP, MK-886-binding Protein) (MaxLight 650)

Sign In for Pricing
View Details