Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GK2 Peptide - N-terminal region

GK2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GKP2, GKTA

UniProt

Q14410

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GK2 Rabbit Polyclonal Antibody (orb582237) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149991

Preservative

Lyophilized powder

AA Sequence

DKLTGEPLYNAVVWLDLRTQTTVEDLSKKIPGNSNFVKSKTGLPLSTYFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AAMP
519652-01 100 µL

AAMP

Sign In for Pricing
View Details
AAMP
519652-02 200 µL

AAMP

Sign In for Pricing
View Details
F13A1 Adenovirus (Rat)
19610056 1.0 mL

F13A1 Adenovirus (Rat)

Sign In for Pricing
View Details
Med15 (Mediator of RNA Polymerase II Transcription Subunit 15, Mediator Complex Subunit 15, Positive Cofactor 2 glutamine/Q-rich-Associated Protein, PC2 glutamine/Q-rich-Associated Protein, mPcqap, Med15, Pcqap) (PE)
MBS6457184-01 0.2 mL

Med15 (Mediator of RNA Polymerase II Transcription Subunit 15, Mediator Complex Subunit 15, Positive Cofactor 2 glutamine/Q-rich-Associated Protein, PC2 glutamine/Q-rich-Associated Protein, mPcqap, Med15, Pcqap) (PE)

Sign In for Pricing
View Details
Med15 (Mediator of RNA Polymerase II Transcription Subunit 15, Mediator Complex Subunit 15, Positive Cofactor 2 glutamine/Q-rich-Associated Protein, PC2 glutamine/Q-rich-Associated Protein, mPcqap, Med15, Pcqap) (PE)
MBS6457184-02 5x 0.2 mL

Med15 (Mediator of RNA Polymerase II Transcription Subunit 15, Mediator Complex Subunit 15, Positive Cofactor 2 glutamine/Q-rich-Associated Protein, PC2 glutamine/Q-rich-Associated Protein, mPcqap, Med15, Pcqap) (PE)

Sign In for Pricing
View Details
Apolipoprotein C2 (APOC2) Antibody
abx104940-01 100 µL

Apolipoprotein C2 (APOC2) Antibody

Sign In for Pricing
View Details