Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GK2 Peptide - N-terminal region

GK2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GKP2, GKTA

UniProt

Q14410

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GK2 Rabbit Polyclonal Antibody (orb582237) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149991

Preservative

Lyophilized powder

AA Sequence

DKLTGEPLYNAVVWLDLRTQTTVEDLSKKIPGNSNFVKSKTGLPLSTYFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDKN3 (NM_001130851) Human Tagged ORF Clone
RC225176 10 µg

CDKN3 (NM_001130851) Human Tagged ORF Clone

Sign In for Pricing
View Details
HLA-DRB (MHC II) (DA2), CF568 conjugate, 0.1mg/mL
BNC682281-500 1x 500 µL

HLA-DRB (MHC II) (DA2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse CD11b/Integrin alpha M (NP_032427) VersaClone cDNA
RDC1740 10 µg

Mouse CD11b/Integrin alpha M (NP_032427) VersaClone cDNA

Sign In for Pricing
View Details
Human Neuropeptide FF (NPFF) ELISA Kit
RDR-NPFF-Hu-48Tests 48 Tests

Human Neuropeptide FF (NPFF) ELISA Kit

Sign In for Pricing
View Details
Anti-C9orf140 Polyclonal Antibody
TMAB-00265-01 50 μL

Anti-C9orf140 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-C9orf140 Polyclonal Antibody
TMAB-00265-02 100 µL

Anti-C9orf140 Polyclonal Antibody

Sign In for Pricing
View Details