Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLCCI1 Peptide - middle region

GLCCI1 Peptide - middle region

Product Specifications

Product Name Alternative

FAM117C, GIG18, GCTR, TSSN1

UniProt

Q86VQ1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GLCCI1 Rabbit Polyclonal Antibody (orb581764) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612435

Preservative

Lyophilized powder

AA Sequence

PYLTGQWPRDPHVHYPSCMKDKATQTPSCWAEEGAEKRSHQRSASWGSAD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OCT3/4 (C279) (POU5F1, OCT3, OCT4, OTF3, POU domain, class 5, transcription factor 1, Octamer-binding protein 3, Octamer-binding protein 4, Octamer-binding transcription factor 3) (Biotin)
MBS6327559-01 0.2 mL

OCT3/4 (C279) (POU5F1, OCT3, OCT4, OTF3, POU domain, class 5, transcription factor 1, Octamer-binding protein 3, Octamer-binding protein 4, Octamer-binding transcription factor 3) (Biotin)

Sign In for Pricing
View Details
OCT3/4 (C279) (POU5F1, OCT3, OCT4, OTF3, POU domain, class 5, transcription factor 1, Octamer-binding protein 3, Octamer-binding protein 4, Octamer-binding transcription factor 3) (Biotin)
MBS6327559-02 5x 0.2 mL

OCT3/4 (C279) (POU5F1, OCT3, OCT4, OTF3, POU domain, class 5, transcription factor 1, Octamer-binding protein 3, Octamer-binding protein 4, Octamer-binding transcription factor 3) (Biotin)

Sign In for Pricing
View Details
PUM2 Protein Vector (Rat) (pPB-N-His)
PV297423 500 ng

PUM2 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Anti-RRN3 Antibody Picoband
MBS1758606-01 0.01 mg

Anti-RRN3 Antibody Picoband

Sign In for Pricing
View Details
Anti-RRN3 Antibody Picoband
MBS1758606-02 0.1 mg (Carrier Free)

Anti-RRN3 Antibody Picoband

Sign In for Pricing
View Details
Anti-RRN3 Antibody Picoband
MBS1758606-03 0.1 mg

Anti-RRN3 Antibody Picoband

Sign In for Pricing
View Details