Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Glis1 Peptide - N-terminal region

Glis1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Gli5, Gli6, GliH1

UniProt

Q8K1M4

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Glis1 Rabbit Polyclonal Antibody (orb576326) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_671754

Preservative

Lyophilized powder

AA Sequence

DKRPKEAPGAPGQGRGPVSLGAHMAFRIAVSGGGCGDGNPLDLLPRLPVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAPSO Buffer 0.2M, pH 9.0
40320017-1 100 mL

CAPSO Buffer 0.2M, pH 9.0

Sign In for Pricing
View Details
Nulp1 (A-6) Alexa Fluor® 680
sc-514203 AF680 200 µg/mL

Nulp1 (A-6) Alexa Fluor® 680

Sign In for Pricing
View Details
SUGP1 AAV Vector (Human) (CMV)
45830101 1 µg

SUGP1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
OKAO00107-96W
OKAO00107-96W 96 Well

OKAO00107-96W

Sign In for Pricing
View Details
Anti-Luteinizing Hormone Antibody (Anti LH) BioAssayTM ELISA Kit (Human) discontinued
587386 96 Tests

Anti-Luteinizing Hormone Antibody (Anti LH) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Tnfsf4 Antibody (Biotin)
orb1271323 0.025 mg

Tnfsf4 Antibody (Biotin)

Sign In for Pricing
View Details