Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Glis1 Peptide - N-terminal region

Glis1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Gli5, Gli6, GliH1

UniProt

Q8K1M4

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Glis1 Rabbit Polyclonal Antibody (orb576326) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_671754

Preservative

Lyophilized powder

AA Sequence

DKRPKEAPGAPGQGRGPVSLGAHMAFRIAVSGGGCGDGNPLDLLPRLPVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COTL1 (C-term) Rabbit pAb
E2616812 100 µL

COTL1 (C-term) Rabbit pAb

Sign In for Pricing
View Details
Anti-Human IgA, IgG, IgM (H+L), Mouse Serum Absorbed - 90nm Gold Conjugate
AC-90-14 1 mL

Anti-Human IgA, IgG, IgM (H+L), Mouse Serum Absorbed - 90nm Gold Conjugate

Sign In for Pricing
View Details
Human CCND1 Pre-designed siRNA Set A
SI002470A 1 Each

Human CCND1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Porcine basic fibroblast growth factor, bFGF ELISA Kit
CK-bio-20191-01 48 Tests

Porcine basic fibroblast growth factor, bFGF ELISA Kit

Sign In for Pricing
View Details
Porcine basic fibroblast growth factor, bFGF ELISA Kit
CK-bio-20191-02 96 Tests

Porcine basic fibroblast growth factor, bFGF ELISA Kit

Sign In for Pricing
View Details
Porcine basic fibroblast growth factor, bFGF ELISA Kit
CK-bio-20191-03 5x 96 Tests

Porcine basic fibroblast growth factor, bFGF ELISA Kit

Sign In for Pricing
View Details