Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Glis1 Peptide - N-terminal region

Glis1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Gli5, Gli6, GliH1

UniProt

Q8K1M4

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Glis1 Rabbit Polyclonal Antibody (orb576326) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_671754

Preservative

Lyophilized powder

AA Sequence

DKRPKEAPGAPGQGRGPVSLGAHMAFRIAVSGGGCGDGNPLDLLPRLPVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD90 (AF-9), CF405M conjugate, 0.1mg/mL
BNC050987-500 1x 500 µL

CD90 (AF-9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Phospho-HNF4 (Ser304) Rabbit Polyclonal Antibody (BF680)
orb1576931 100 µL

Phospho-HNF4 (Ser304) Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Recombinant Mouse FOXN3 Protein, His (Fc)-Avi-tagged
FOXN3-3332M 50 µg

Recombinant Mouse FOXN3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
C8orf58 Human shRNA Lentiviral Particle (Locus ID 541565)
TL314275V 500 µL Each

C8orf58 Human shRNA Lentiviral Particle (Locus ID 541565)

Sign In for Pricing
View Details
Rhesus DDR2 HEK293 Overexpression Lysate
MBS8117919-01 0.3 mg

Rhesus DDR2 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
Rhesus DDR2 HEK293 Overexpression Lysate
MBS8117919-02 5x 0.3 mg

Rhesus DDR2 HEK293 Overexpression Lysate

Sign In for Pricing
View Details