Glis1 Peptide - N-terminal region
Glis1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
Gli5, Gli6, GliH1
UniProt
Q8K1M4
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Glis1 Rabbit Polyclonal Antibody (orb576326) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_671754
Preservative
Lyophilized powder
AA Sequence
DKRPKEAPGAPGQGRGPVSLGAHMAFRIAVSGGGCGDGNPLDLLPRLPVP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
R9400-01H-FITC 200 µL
RSK2, phosphorylated (Ser369) (Ribosomal S6 Kinase 2, RSK2, RSK-2, p90-RSK2, pp90RSK2, 90kD Ribosomal Protein S6 Kinase 3, p90-RSK 3, p90RSK3, Insulin-stimulated Protein Kinase 1, ISPK1, ISPK-1, MAP Kinase-activated Protein Kinase 1b, MAPK-activated Protein Kinase 1b, MAPKAP Kinase 1b, MAPKAPK1B, MAPKAPK-1b, Ribosomal Protein S6 Kinase alpha-3, RPS6KA3, S6K-alpha3, S6K-alpha-3) (FITC) discontinued
Sign In for Pricing
View Details 
JH919413 1 Each
4',5'-Dichloro-2',7'-dimethoxy-6-carboxyfluorescein
Sign In for Pricing
View Details 