Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLOD4 Peptide - N-terminal region

GLOD4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C17orf25, CGI-150, HC71

UniProt

D3DTG9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GLOD4 Rabbit Polyclonal Antibody (orb583332) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057164

Preservative

Lyophilized powder

AA Sequence

EEFEEGCKAACNGPYDGKWSKTMVGFGPEDDHFVAELTYNYGVGDYKLGN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

F110D Rabbit Polyclonal Antibody
JOT-AP09854-01 20 µL

F110D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
F110D Rabbit Polyclonal Antibody
JOT-AP09854-02 50 μL

F110D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
F110D Rabbit Polyclonal Antibody
JOT-AP09854-03 100 µL

F110D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Palmdelphin (PALMD) ELISA Kit
MBS4501646-01 48 Tests

Human Palmdelphin (PALMD) ELISA Kit

Sign In for Pricing
View Details
Human Palmdelphin (PALMD) ELISA Kit
MBS4501646-02 96 Tests

Human Palmdelphin (PALMD) ELISA Kit

Sign In for Pricing
View Details
Human Palmdelphin (PALMD) ELISA Kit
MBS4501646-03 5x 96 Tests

Human Palmdelphin (PALMD) ELISA Kit

Sign In for Pricing
View Details