Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Glra3 Peptide - middle region

Glra3 Peptide - middle region

Product Specifications

UniProt

Q91XP5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Glra3 Rabbit Polyclonal Antibody (orb324590) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_536686

Preservative

Lyophilized powder

AA Sequence

SLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ohaus STP275 Printer cable for Adventure Pro MB series and Discovery balances
BAL5510 1 Each

Ohaus STP275 Printer cable for Adventure Pro MB series and Discovery balances

Sign In for Pricing
View Details
SLC22A9 Antibody; FITC conjugated
MBS7001014-01 0.05 mg

SLC22A9 Antibody; FITC conjugated

Sign In for Pricing
View Details
SLC22A9 Antibody; FITC conjugated
MBS7001014-02 0.1 mg

SLC22A9 Antibody; FITC conjugated

Sign In for Pricing
View Details
SLC22A9 Antibody; FITC conjugated
MBS7001014-03 5x 0.1 mg

SLC22A9 Antibody; FITC conjugated

Sign In for Pricing
View Details
KLHL34 CRISPRa sgRNA lentivector (set of three targets)(Human)
25799121 3x 1.0µg DNA

KLHL34 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Golgin 45 rabbit pAb
ES7816-01 50 µL

Golgin 45 rabbit pAb

Sign In for Pricing
View Details