GLRX2 Peptide - middle region
GLRX2 Peptide - middle region
Product Specifications
Product Name Alternative
GRX2, bA101E13.1, CGI-133
UniProt
Q9NS18
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GLRX2 Rabbit Polyclonal Antibody (orb583716) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_932066
Preservative
Lyophilized powder
AA Sequence
NVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6253101-01 0.1 mL
NKp46, Natural Cytotoxicity Receptor (NCR NKp46, CD335, Lymphocyte Antigen 94, Ly94, Natural Cytotoxicity Triggering Receptor 1, NCR1, NCT1, Natural Killer Cell Activating Receptor NKp46, NK Cell Activating Receptor) (MaxLight 405)
Sign In for Pricing
View Details MBS6253101-02 5x 0.1 mL
NKp46, Natural Cytotoxicity Receptor (NCR NKp46, CD335, Lymphocyte Antigen 94, Ly94, Natural Cytotoxicity Triggering Receptor 1, NCR1, NCT1, Natural Killer Cell Activating Receptor NKp46, NK Cell Activating Receptor) (MaxLight 405)
Sign In for Pricing
View Details bs-16052R-BF594 100 µL
FBXO48 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
Sign In for Pricing
View Details