Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLUD2 Peptide - N-terminal region

GLUD2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GDH2, GLUDP1

UniProt

P49448

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GLUD2 Rabbit Polyclonal Antibody (orb582504) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036216

Preservative

Lyophilized powder

AA Sequence

EGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MetAP1
CR21-01 10 µg

Recombinant Human MetAP1

Sign In for Pricing
View Details
Recombinant Human MetAP1
CR21-02 50 µg

Recombinant Human MetAP1

Sign In for Pricing
View Details
Recombinant Human MetAP1
CR21-03 500 µg

Recombinant Human MetAP1

Sign In for Pricing
View Details
Recombinant Human MetAP1
CR21-04 1 mg

Recombinant Human MetAP1

Sign In for Pricing
View Details
Human Sonic Hedgehog/SHH (C24II), Tag Free
HA211279-01 20 µg

Human Sonic Hedgehog/SHH (C24II), Tag Free

Sign In for Pricing
View Details
Human Sonic Hedgehog/SHH (C24II), Tag Free
HA211279-02 50 µg

Human Sonic Hedgehog/SHH (C24II), Tag Free

Sign In for Pricing
View Details