Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLUL Peptide - C-terminal region

GLUL Peptide - C-terminal region

Product Specifications

Product Name Alternative

GLNS, GS, PIG43, PIG59

UniProt

P15104

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GLUL Rabbit Polyclonal Antibody (orb584389) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002056

Preservative

Lyophilized powder

AA Sequence

TGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human UNC80 shRNA Plasmid
abx967070-01 150 µg

Human UNC80 shRNA Plasmid

Sign In for Pricing
View Details
Human UNC80 shRNA Plasmid
abx967070-02 300 µg

Human UNC80 shRNA Plasmid

Sign In for Pricing
View Details
Human CD42d/GP5 Recombinant Protein
PPT-11570 100 µg

Human CD42d/GP5 Recombinant Protein

Sign In for Pricing
View Details
Rabbit Polyclonal PIST Antibody [Alexa Fluor 405]
NBP1-77243AF405 0.1 mL

Rabbit Polyclonal PIST Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
VWC2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
50241066 1.0 µg DNA

VWC2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
PTPRN2 (Protein Tyrosine Phosphatase, Receptor Type, N Polypeptide 2, IA-2beta, IAR, ICAAR, PTPRP) (MaxLight 550)
MBS6218839-01 0.1 mL

PTPRN2 (Protein Tyrosine Phosphatase, Receptor Type, N Polypeptide 2, IA-2beta, IAR, ICAAR, PTPRP) (MaxLight 550)

Sign In for Pricing
View Details