Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLUL Peptide - C-terminal region

GLUL Peptide - C-terminal region

Product Specifications

Product Name Alternative

GLNS, GS, PIG43, PIG59

UniProt

P15104

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GLUL Rabbit Polyclonal Antibody (orb584389) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002056

Preservative

Lyophilized powder

AA Sequence

TGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Orosomucoid 2 Protein
NBP2-59560-250ug 250 µg

Recombinant Human Orosomucoid 2 Protein

Sign In for Pricing
View Details
Mouse Ndufc2 ELISA KIT
ELI-22997m 96 Tests

Mouse Ndufc2 ELISA KIT

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. mediasiatica Lipoprotein signal peptidase (lspA), partial
MBS7067010 Inquire

Recombinant Francisella tularensis subsp. mediasiatica Lipoprotein signal peptidase (lspA), partial

Sign In for Pricing
View Details
Nori® Porcine VASA ELISA Kit
GR113433 96 Well

Nori® Porcine VASA ELISA Kit

Sign In for Pricing
View Details
CKS2 Antibody : HRP (OAAF02238-HRP)
OAAF02238-100UG-HRP 100 µg

CKS2 Antibody : HRP (OAAF02238-HRP)

Sign In for Pricing
View Details
Mouse Monoclonal CD69 Antibody (15B5G2) [Alexa Fluor 700]
NBP2-25242AF700 0.1 mL

Mouse Monoclonal CD69 Antibody (15B5G2) [Alexa Fluor 700]

Sign In for Pricing
View Details