Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLYCTK Peptide - middle region

GLYCTK Peptide - middle region

Product Specifications

Product Name Alternative

GLYCTK1, HBEBP2, HBeAgBP4A, HBEBP4

UniProt

Q8IVS8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GLYCTK Rabbit Polyclonal Antibody (orb580195) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_660305

Preservative

Lyophilized powder

AA Sequence

KPHSRVQVFEGAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRDM1 Human Gene Knockout Kit (CRISPR)
KN217363 1 Kit

PRDM1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Procr Mouse Gene Knockout Kit (CRISPR)
KN513945 1 Kit

Procr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NFIB / NF1B2 Mouse Monoclonal Antibody [1H1]
EM1701-89 100 µL

NFIB / NF1B2 Mouse Monoclonal Antibody [1H1]

Sign In for Pricing
View Details
Axin 2 (AXIN2) (NM_004655) Human Over-expression Lysate
LC401475 20 µg

Axin 2 (AXIN2) (NM_004655) Human Over-expression Lysate

Sign In for Pricing
View Details
DNLZ (NM_001080849) Human Over-expression Lysate
LY421129 100 µg

DNLZ (NM_001080849) Human Over-expression Lysate

Sign In for Pricing
View Details
SERPINI2 Human qPCR Primer Pair (NM_006217)
HP230171 200 Reactions

SERPINI2 Human qPCR Primer Pair (NM_006217)

Sign In for Pricing
View Details