Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gm527 Peptide - C-terminal region

Gm527 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC117765

UniProt

Q4KL13

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gm527 Rabbit Polyclonal Antibody (orb325694) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020776

Preservative

Lyophilized powder

AA Sequence

CHGAPPFVVLNMQHWKPEDLAYVPYYLDLSDHKYLLEGATLFNKEEHHYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin V (ANXA5) Mouse Monoclonal Antibody [Clone ID: RUU-WAC2A]
AM32999PU-N 100 µg

Annexin V (ANXA5) Mouse Monoclonal Antibody [Clone ID: RUU-WAC2A]

Sign In for Pricing
View Details
DNAI2 Antibody
KC-45036-01 50 μL

DNAI2 Antibody

Sign In for Pricing
View Details
DNAI2 Antibody
KC-45036-02 100 µL

DNAI2 Antibody

Sign In for Pricing
View Details
DNAI2 Antibody
KC-45036-03 1 mL

DNAI2 Antibody

Sign In for Pricing
View Details
NETosis Colorimetric Assay Kit
E-BC-K884-M-01 48 T (32 samples)

NETosis Colorimetric Assay Kit

Sign In for Pricing
View Details
NETosis Colorimetric Assay Kit
E-BC-K884-M-02 96 T (80 samples)

NETosis Colorimetric Assay Kit

Sign In for Pricing
View Details