Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gm527 Peptide - C-terminal region

Gm527 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC117765

UniProt

Q4KL13

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gm527 Rabbit Polyclonal Antibody (orb325694) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020776

Preservative

Lyophilized powder

AA Sequence

CHGAPPFVVLNMQHWKPEDLAYVPYYLDLSDHKYLLEGATLFNKEEHHYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N6-(2-Carboxyacetyl)-L-lysine-d4
TRC-C178064-5MG 5 mg

N6-(2-Carboxyacetyl)-L-lysine-d4

Sign In for Pricing
View Details
Mouse Plcd4 activation kit by CRISPRa
GA203281 1 Kit

Mouse Plcd4 activation kit by CRISPRa

Sign In for Pricing
View Details
CD95 (FAS) Rabbit Polyclonal Antibody
TA384208 100 µL

CD95 (FAS) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PPME1 Human Gene Knockout Kit (CRISPR)
KN200009 1 Kit

PPME1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
L-Histidinol Dihydrochloride
TRC-H456300-1G 1 g

L-Histidinol Dihydrochloride

Sign In for Pricing
View Details
HMGN2 Recombinant Rabbit Monoclonal Antibody [JE53-85]
ET7110-38 100 µL

HMGN2 Recombinant Rabbit Monoclonal Antibody [JE53-85]

Sign In for Pricing
View Details